PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA10G0136800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 318aa    MW: 34459.4 Da    PI: 7.6692
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA10G0136800.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-1395139347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+ +++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
  ORGLA10G0136800.1  95 PWTEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 139
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.105.6E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.99788144IPR017930Myb domain
SuperFamilySSF466892.99E-1790145IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1991143IPR006447Myb domain, plants
SMARTSM007171.0E-1092142IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-1192138IPR009057Homeodomain-like
CDDcd001675.65E-995140No hitNo description
PfamPF002494.8E-1195139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKIFGVRL TDGSIRKSAS MGNLSLLSSA AGSTSGGASP  60
ADGPDAAPTA ADGYASDDFV QGSSSATRDR KKGVPWTEEE HRRFLLGLQK LGKGDWRGIS  120
RNFVVSRTPT QVASHAQKYF IRQSNMTRRK RRSSLFDMVP DESMDLPPLP GGQEPETQVL  180
NQPALPPPRG EEEVDSMESD TSAIAESSSA SAIMPDNLQS TYPVIVPAYF SPFLQFSVPF  240
WQNRKDEDGP VQETHEIVKP VPVHSKSPIN VDELVGMSKL SIGESNQETV STSLSLNLVG  300
GQNRQSAFHA NPPTRAQA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1010620.0AK101062.1 Oryza sativa Japonica Group cDNA clone:J033022I10, full insert sequence.
GenBankEU8372540.0EU837254.1 Oryza sativa Japonica Group clone KCS344D12 myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614288.10.0PREDICTED: transcription factor MYB1R1
TrEMBLI1QVY50.0I1QVY5_ORYGL; Uncharacterized protein
STRINGORGLA10G0136800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19393791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-98MYB_related family protein